PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.92BTQ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 213aa    MW: 24271.4 Da    PI: 5.1272
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.92BTQgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM106.24e-33191381128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGf F+Ptdeelv ++L +k++  +++  ++i+++d+  ++P++L+ k+ ++ +++yfFsk ++        +r+t++gyWk+ g+++++ls+  +
  Araip.92BTQ  19 LPPGFLFSPTDEELVLHFLYAKASLLPCHP-NIIPDLDLSLAHPSQLNDKALSSGNQYYFFSKVKE--------KRITENGYWKEIGESEAILSStVE 107
                  79*************************999.89**************9777778899999999755........699****************98667 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  ++vg+kk Lvf+ g+ap+g +t+Wvm+ey++
  Araip.92BTQ 108 KKVGTKKNLVFHIGEAPHGIETSWVMQEYHI 138
                  88***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.02E-4015170IPR003441NAC domain
PROSITE profilePS5100538.59119170IPR003441NAC domain
PfamPF023653.4E-2020138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MMMMTTTSTT ADYESVKQLP PGFLFSPTDE ELVLHFLYAK ASLLPCHPNI IPDLDLSLAH  60
PSQLNDKALS SGNQYYFFSK VKEKRITENG YWKEIGESEA ILSSTVEKKV GTKKNLVFHI  120
GEAPHGIETS WVMQEYHICR SSNIISTSRA RRKHDHQIWS KWVLCKVYEK KGSVRGVNYC  180
SDDDDSGTEL SWLDEIYLSL DDDLEEISVS ILD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-301917520173NAC domain-containing protein 19
3swm_B5e-301917520173NAC domain-containing protein 19
3swm_C5e-301917520173NAC domain-containing protein 19
3swm_D5e-301917520173NAC domain-containing protein 19
3swp_A5e-301917520173NAC domain-containing protein 19
3swp_B5e-301917520173NAC domain-containing protein 19
3swp_C5e-301917520173NAC domain-containing protein 19
3swp_D5e-301917520173NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016179197.11e-159PREDICTED: NAC domain-containing protein 104-like isoform X1
SwissprotQ8GWK65e-56NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A0B2RGV52e-90A0A0B2RGV5_GLYSO; NAC domain-containing protein 68
TrEMBLI1JY112e-90I1JY11_SOYBN; NAC transcription factor
TrEMBLV7AZY13e-90V7AZY1_PHAVU; Uncharacterized protein
STRINGGLYMA04G38990.16e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.16e-57xylem NAC domain 1